LL37 5MG

LL-37 is a natural peptide made by our immune system to fight infections. It helps kill bacteria, viruses, and fungi directly and also supports wound healing and reduces inflammation. Unlike traditional antibiotics that target specific germs, LL-37 works broadly and boosts the body’s first line of defense. It also helps repair tissues by encouraging new blood vessels to form and cells to grow. People are studying LL-37 for its potential to help with infections, chronic inflammation, and healing skin or gut injuries.

Original price was: $80.00.Current price is: $65.00.

The information provided on this page is intended solely as a general summary. It does not encompass all potential research applications, handling procedures, safety precautions, interactions, or observed effects. These products are supplied strictly for laboratory and research purposes only. They are not intended for human consumption, medical use, veterinary use, or diagnostic purposes. This information must not be considered a substitute for professional expertise, judgment, or regulatory guidance.

Money Back Guarantee

Guaranteed Quality

Fast Shipping

10+ Years Experience

Frequently Bought Together

Original price was: $80.00.Current price is: $58.50.
Original price was: $185.00.Current price is: $108.00.
Original price was: $75.00.Current price is: $67.50.
Original price was: $50.00.Current price is: $45.00.
Original price was: $390.00.Current price is: $279.00.
For 4 items

SEQUENCE/FORMULA

Sequence: [LL-37, 37 aa] Molecular Formula: C205H340N60O53

MOLECULAR WEIGHT

4493 g/mol

PUBCHEM CID

16198951
  • Helps study how the body fights bacteria, viruses, and fungi naturally.

  • Used to explore new ways to heal wounds and recover from injuries faster.

  • Investigated for reducing long-term inflammation in chronic illnesses.

  • Tested for boosting the immune system against colds and flu.

  • Explored for improving gut health and protecting the digestive lining.

  • Breaks down harmful bacteria and viruses by disrupting their outer membranes.

  • Attracts immune cells to infection sites to help fight disease.

  • Reduces harmful inflammation while promoting healing.

  • Helps form new blood vessels to speed wound recovery.

  • Prevents bacteria from forming protective layers (biofilms) that resist antibiotics.

  • RevolutionHealth.org, 2025 – overview of immunity and healing​

  • Swolverine.com, 2025 – beginner’s guide to LL-37 benefits​

  • Frontiers in Immunology, 2022 – immune modulation and infection control.