Back to Products
LIPO-C 216 10ML - Image 1

LIPO-C 216 10ML

Lipo-C 216 is a synthetic lipopeptide, which means it has both fat-like and protein parts. This design helps it fight bacteria by breaking their outer membranes, making it useful in preventing infections. It also can stop bacteria from forming protective layers, making it easier to eliminate them. Scientists are exploring how this compound could be used in food safety, medical devices, and vaccines because of its ability to target tough germs in a gentle way that works well with the body.

Contains:

L-Carnitine 20mg    Methionine 25mg Choline 50mg B5(Dexpanthenol) 25mg
L-Arginine 20mg Inositol 50mg B6 (Pyridoxine) 25mg B12 (Methylcobalamin)10 ml
Learn more

$75.00

Add to wishlist

The information provided on this page is intended solely as a general summary. It does not encompass all potential research applications, handling procedures, safety precautions, interactions, or observed effects. These products are supplied strictly for laboratory and research purposes only. They are not intended for human consumption, medical use, veterinary use, or diagnostic purposes. This information must not be considered a substitute for professional expertise, judgment, or regulatory guidance.

Money Back Guarantee

Guaranteed Quality

Fast Shipping

10+ Years Experience

Frequently Bought Together

-10%
Add to wishlist

LIPO-C 216 10ML

, , ,
Original price was: $75.00.Current price is: $67.50.
Quick view
-44%-38%
Add to wishlist

MOTS-C – 40MG

,
Original price was: $240.00.Current price is: $135.00.
Quick view
-26%-18%Hot
Add to wishlist

CJC-1295 + IPAMORELIN 5/5MG

, , , ,
Original price was: $110.00.Current price is: $81.00.
Quick view
-46%-40%
Add to wishlist

SEMA 5MG

, ,
Original price was: $150.00.Current price is: $81.00.
Quick view
Original price was: $75.00.Current price is: $67.50.
Original price was: $240.00.Current price is: $135.00.
Original price was: $110.00.Current price is: $81.00.
Original price was: $150.00.Current price is: $81.00.
Original price was: $575.00.Current price is: $364.50.
For 4 items

SEQUENCE/FORMULA

Sequence: [LL-37, 37 aa] Molecular Formula: C205H340N60O53

MOLECULAR WEIGHT

4493 g/mol

PUBCHEM CID

16198951

  • Studied as a new type of antimicrobial agent to prevent infections on surfaces.

  • Explored for use in food safety to kill harmful bacteria and fungi.

  • Tested for its ability to break up bacterial communities (biofilms) that cause disease.

  • Investigated as a helper in vaccines to boost immune response.

  • Evaluated for its potential in cleaning or protecting medical devices.

  • Inserts into bacterial membranes and breaks them apart like a detergent.

  • Forms tiny clusters that damage harmful microbes.

  • Causes bacteria to leak out essential parts and die.

  • Specifically works against tough-to-kill germs, including resistant strains.

  • Studies on ultrashort lipopeptides, PNAS 2006​

  • Food Control journal, 2025 – food pathogen inhibition​

  • Frontiers in Microbiology, 2025 – membrane disruption by lipopeptides.